PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_193070_widh.t1
Common NameSOVF_193070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family GATA
Protein Properties Length: 276aa    MW: 29894.3 Da    PI: 6.255
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_193070_widh.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.91.6e-19192226135
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                        Cs+Cg+ kTp+WR gp+g ktLCnaCG+++++ +l
  Sp_193070_widh.t1 192 CSHCGVQKTPQWRAGPEGAKTLCNACGVRFKSGRL 226
                        *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.754186222IPR000679Zinc finger, GATA-type
SMARTSM004014.5E-17186240IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.14E-13188249No hitNo description
Gene3DG3DSA:3.30.50.101.8E-15190224IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.24E-13191239No hitNo description
PROSITE patternPS003440192217IPR000679Zinc finger, GATA-type
PfamPF003201.8E-17192226IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MEFKEHPETN SVSGEDLFVD QLLNLNNEEE EEDGGAELEP ENRPNIIVVE DEEDNNSCKF  60
SPLLSPPLES VLSVPEEEAD LEWLSHFVEE SFSQISTPYP PGLLQPNPKP GNQPTPANLS  120
KSRRSKRVRT GAGGRVWSTS GSDTFSPYST PLCCPSSSGI GPPKKRRKKE NGTVSGGGSG  180
GGGGLPCMPR RCSHCGVQKT PQWRAGPEGA KTLCNACGVR FKSGRLLPEY RPACSPTFSS  240
ELHSSSHRKV LEMRKKKETG QPDSVSGFHL LVSGFG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163167KKRRK
2163168KKRRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010679831.11e-86PREDICTED: GATA transcription factor 7
TrEMBLA0A0K9QER50.0A0A0K9QER5_SPIOL; Uncharacterized protein
STRINGVIT_04s0023g02880.t011e-53(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-46GATA transcription factor 7